PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 389aa    MW: 42441.4 Da    PI: 9.9969
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018220genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-17107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ed +l+++vkq+G + W+ Ia+++  gR +kqc++rw+++l
      Lus10018220 107 KGQWTEDEDRKLIRLVKQFGIRKWAEIAQRLS-GRAGKQCRERWHNHL 153
                      799*****************************.*************97 PP

2Myb_DNA-binding55.21.6e-17161201345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       W++eE+ +lvda+++ G++ W+ Ia+ ++ gRt++ +k++w+
      Lus10018220 161 GWSEEEERILVDAHAKIGNR-WAEIAKLIP-GRTENAIKNHWN 201
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.343102157IPR017930Myb domain
SuperFamilySSF466893.38E-30105200IPR009057Homeodomain-like
SMARTSM007171.1E-15106155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-27108160IPR009057Homeodomain-like
PfamPF139219.1E-18110167No hitNo description
CDDcd001679.63E-15110153No hitNo description
SMARTSM007173.7E-16158206IPR001005SANT/Myb domain
PROSITE profilePS5129419.721158208IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-20161206IPR009057Homeodomain-like
CDDcd001673.00E-12162204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MTNWNSSAAV PISKQPAIVA AANELLYGGG GGGVNNYNLT AAGWSAAAAP VADFDWTWER  60
LMMNMRNSNP NDVAAAGEGT NKKKKKNNKG SVVVKKRQSS CSAALIKGQW TEDEDRKLIR  120
LVKQFGIRKW AEIAQRLSGR AGKQCRERWH NHLRPDIKKE GWSEEEERIL VDAHAKIGNR  180
WAEIAKLIPG RTENAIKNHW NATKRRQNSR RKHPKSKSTA ETNATNAVKS HSSSSSILQD  240
YIRSKTLQLN QPTTTTSTTP SSASSGVDGD GDGGSLVPSL SESDEELLFM QNLFASKPLD  300
AGHVDDINGR DRPGFHHAAP SSRHGHHHLY SDLYVSYLLN GGASYASSSG LRDADKAAEG  360
GMLSLEMMDH RGNKKEMDLI EMLSSTAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-461052072104MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-468820738158MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-468820738158MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-461052072104C-Myb DNA-Binding Domain
1msf_C6e-461052072104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744461e-165JX174446.1 Linum usitatissimum clone LuBAC375M9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035335.15e-86PREDICTED: transcription factor MYB98-like
TrEMBLI6XCR30.0I6XCR3_LINUS; Myb-like DNA-binding domain protein
STRINGPOPTR_0001s25710.11e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-76myb domain protein 119